Lineage for d3h3fc2 (3h3f C:160-331)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2999256Protein automated matches [226882] (10 species)
    not a true protein
  7. 2999410Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225719] (6 PDB entries)
  8. 2999441Domain d3h3fc2: 3h3f C:160-331 [210819]
    Other proteins in same PDB: d3h3fa1, d3h3fb1, d3h3fc1, d3h3fd1, d3h3fe1, d3h3ff1, d3h3fg1, d3h3fh1
    automated match to d9ldta2
    complexed with act, nai, oxm

Details for d3h3fc2

PDB Entry: 3h3f (more details), 2.38 Å

PDB Description: Rabbit muscle L-lactate dehydrogenase in complex with NADH and oxamate
PDB Compounds: (C:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d3h3fc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h3fc2 d.162.1.1 (C:160-331) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
sgcnldsarfrylmgerlgvhalschgwilgehgdssvpvwsgmnvagvslktlhpelgt
dadkeqwkqvhkqvvdsayeviklkgyttwaiglsvadlaesimknlrrvhpistmlkgl
ygikedvflsvpcvlgqngisdvvkvtltseeeahlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d3h3fc2:

Click to download the PDB-style file with coordinates for d3h3fc2.
(The format of our PDB-style files is described here.)

Timeline for d3h3fc2: