| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
| Protein automated matches [226881] (8 species) not a true protein |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225718] (6 PDB entries) |
| Domain d3h3fh1: 3h3f H:1-159 [210828] Other proteins in same PDB: d3h3fa2, d3h3fb2, d3h3fc2, d3h3fd2, d3h3fe2, d3h3ff2, d3h3fg2, d3h3fh2 automated match to d9ldta1 complexed with act, nai, oxm |
PDB Entry: 3h3f (more details), 2.38 Å
SCOPe Domain Sequences for d3h3fh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h3fh1 c.2.1.5 (H:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkysphckllvvsnpvdiltyvawkisgfpknrvig
Timeline for d3h3fh1: