SCOPe 2.08: Domain d3h3fa2: 3h3f A:160-331

Lineage for d3h3fa2 (3h3f A:160-331)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein automated matches [226882] (10 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225719] (6 PDB entries)

8. Domain d3h3fa2: 3h3f A:160-331 [210815]
   Other proteins in same PDB: d3h3fa1, d3h3fb1, d3h3fc1, d3h3fd1, d3h3fe1, d3h3ff1, d3h3fg1, d3h3fh1
   automated match to d9ldta2
   complexed with act, nai, oxm

Details for d3h3fa2

PDB Entry: 3h3f, 2.38 Å

PDB Description: Rabbit muscle L-lactate dehydrogenase in complex with NADH and oxamate

PDB Compounds: (A:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d3h3fa2:

Sequence; same for both SEQRES and ATOM records:

>d3h3fa2 d.162.1.1 (A:160-331) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
sgcnldsarfrylmgerlgvhalschgwilgehgdssvpvwsgmnvagvslktlhpelgt
dadkeqwkqvhkqvvdsayeviklkgyttwaiglsvadlaesimknlrrvhpistmlkgl
ygikedvflsvpcvlgqngisdvvkvtltseeeahlkksadtlwgiqkelqf

Timeline for d3h3fa2:

• d3h3fa2 first appeared in SCOPe 2.03
  
• d3h3fa2 appears in SCOPe 2.07