Lineage for d3h3fg1 (3h3f G:1-159)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844864Protein automated matches [226881] (8 species)
    not a true protein
  7. 2844948Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225718] (6 PDB entries)
  8. 2844983Domain d3h3fg1: 3h3f G:1-159 [210826]
    Other proteins in same PDB: d3h3fa2, d3h3fb2, d3h3fc2, d3h3fd2, d3h3fe2, d3h3ff2, d3h3fg2, d3h3fh2
    automated match to d9ldta1
    complexed with act, nai, oxm

Details for d3h3fg1

PDB Entry: 3h3f (more details), 2.38 Å

PDB Description: Rabbit muscle L-lactate dehydrogenase in complex with NADH and oxamate
PDB Compounds: (G:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d3h3fg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h3fg1 c.2.1.5 (G:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkysphckllvvsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d3h3fg1:

Click to download the PDB-style file with coordinates for d3h3fg1.
(The format of our PDB-style files is described here.)

Timeline for d3h3fg1: