Lineage for d3gana_ (3gan A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737753Fold a.220: Hypothetical protein At3g22680 [109919] (1 superfamily)
    5 helices; array; probable biological unit is a homodimer
  4. 2737754Superfamily a.220.1: Hypothetical protein At3g22680 [109920] (1 family) (S)
    automatically mapped to Pfam PF09187
  5. 2737755Family a.220.1.1: Hypothetical protein At3g22680 [109921] (1 protein)
  6. 2737756Protein Hypothetical protein At3g22680 [109922] (1 species)
  7. 2737757Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [109923] (3 PDB entries)
    Uniprot Q9LUJ3
  8. 2737760Domain d3gana_: 3gan A: [210458]
    automated match to d1vk5a_
    complexed with cl, svr

Details for d3gana_

PDB Entry: 3gan (more details), 2 Å

PDB Description: crystal structure of gene product from arabidopsis thaliana at3g22680 with bound suramin
PDB Compounds: (A:) Uncharacterized protein At3g22680

SCOPe Domain Sequences for d3gana_:

Sequence, based on SEQRES records: (download)

>d3gana_ a.220.1.1 (A:) Hypothetical protein At3g22680 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sllrraemyqdymkqvpiptnrgslipftswvglsismkqlygqplhyltnvllqrwdqs
rfgtdseeqrldsiihptkaeatiwlveeihrltpshlhmallwrsdpmyhsfidpifp

Sequence, based on observed residues (ATOM records): (download)

>d3gana_ a.220.1.1 (A:) Hypothetical protein At3g22680 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sllrraemyqdymkqvpiptnrgslipftswvglsismkqlygqplhyltnvllqrwdqs
rfqrldsiihptkaeatiwlveeihrltpshlhmallwrsdpmyhsfidpifp

SCOPe Domain Coordinates for d3gana_:

Click to download the PDB-style file with coordinates for d3gana_.
(The format of our PDB-style files is described here.)

Timeline for d3gana_: