Lineage for d1vk5a_ (1vk5 A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.220: Hypothetical protein At3g22680 [109919] (1 superfamily)
    5 helices; array; probable biological unit is a homodimer
  4. Superfamily a.220.1: Hypothetical protein At3g22680 [109920] (1 family) (S)
    automatically mapped to Pfam PF09187
  5. Family a.220.1.1: Hypothetical protein At3g22680 [109921] (1 protein)
  6. Protein Hypothetical protein At3g22680 [109922] (1 species)
  7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [109923] (3 PDB entries)
    Uniprot Q9LUJ3
  8. Domain d1vk5a_: 1vk5 A: [108635]
    Structural genomics target
    complexed with cps, edo, so4

Details for d1vk5a_

PDB Entry: 1vk5 (more details), 1.6 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at3g22680
PDB Compounds: (A:) expressed protein

SCOPe Domain Sequences for d1vk5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vk5a_ a.220.1.1 (A:) Hypothetical protein At3g22680 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gsllrraemyqdymkqvpiptnrgslipftswvglsismkqlygqplhyltnvllqrwdq
srfgtdseeqrldsiihptkaeatiwlveeihrltpshlhmallwrsdpmyhsfidpifp
e

SCOPe Domain Coordinates for d1vk5a_ are not available.

Timeline for d1vk5a_: