SCOPe 2.07: Domain d3gana_: 3gan A:

Lineage for d3gana_ (3gan A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.220: Hypothetical protein At3g22680 [109919] (1 superfamily)
   5 helices; array; probable biological unit is a homodimer

4. Superfamily a.220.1: Hypothetical protein At3g22680 [109920] (1 family)
   automatically mapped to Pfam PF09187

5. Family a.220.1.1: Hypothetical protein At3g22680 [109921] (1 protein)

6. Protein Hypothetical protein At3g22680 [109922] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [109923] (3 PDB entries)
   Uniprot Q9LUJ3

8. Domain d3gana_: 3gan A: [210458]
   automated match to d1vk5a_
   complexed with cl, svr

Details for d3gana_

PDB Entry: 3gan, 2 Å

PDB Description: crystal structure of gene product from arabidopsis thaliana at3g22680 with bound suramin

PDB Compounds: (A:) Uncharacterized protein At3g22680

SCOPe Domain Sequences for d3gana_:

Sequence, based on SEQRES records:

>d3gana_ a.220.1.1 (A:) Hypothetical protein At3g22680 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sllrraemyqdymkqvpiptnrgslipftswvglsismkqlygqplhyltnvllqrwdqs
rfgtdseeqrldsiihptkaeatiwlveeihrltpshlhmallwrsdpmyhsfidpifp

Sequence, based on observed residues (ATOM records):

>d3gana_ a.220.1.1 (A:) Hypothetical protein At3g22680 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sllrraemyqdymkqvpiptnrgslipftswvglsismkqlygqplhyltnvllqrwdqs
rfqrldsiihptkaeatiwlveeihrltpshlhmallwrsdpmyhsfidpifp

Timeline for d3gana_:

• d3gana_ first appeared in SCOPe 2.03
  
• d3gana_ appears in SCOPe 2.06
  
• d3gana_ appears in the current release, SCOPe 2.08