PDB entry 3gan

View 3gan on RCSB PDB site
Description: Crystal structure of gene product from Arabidopsis thaliana At3g22680 with bound suramin
Class: structural genomics, unknown function
Keywords: suramin, Structural Genomics Functional Follow-Up Study, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, UNKNOWN FUNCTION
Deposited on 2009-02-17, released 2009-03-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein At3g22680
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g22680, At3g22680.1, MWI23.5, Q9LUJ3, Y3268_ARATH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3gana_
  • Heterogens: SVR, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ganA (A:)
    selrpsgdsgssdvdaeisdgfspldtshrdvadegsllrraemyqdymkqvpiptnrgs
    lipftswvglsismkqlygqplhyltnvllqrwdqsrfgtdseeqrldsiihptkaeati
    wlveeihrltpshlhmallwrsdpmyhsfidpifpek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ganA (A:)
    sllrraemyqdymkqvpiptnrgslipftswvglsismkqlygqplhyltnvllqrwdqs
    rfqrldsiihptkaeatiwlveeihrltpshlhmallwrsdpmyhsfidpifp