Lineage for d3fefb1 (3fef B:7-171)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846077Species Bacillus subtilis [TaxId:1423] [196388] (13 PDB entries)
  8. 2846093Domain d3fefb1: 3fef B:7-171 [209877]
    Other proteins in same PDB: d3fefa2, d3fefb2, d3fefc2, d3fefd2
    automated match to d1obba1
    complexed with mg, so4

Details for d3fefb1

PDB Entry: 3fef (more details), 2.2 Å

PDB Description: crystal structure of putative glucosidase lpld from bacillus subtilis
PDB Compounds: (B:) Putative glucosidase lplD, ALPHA-GALACTURONIDASE

SCOPe Domain Sequences for d3fefb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fefb1 c.2.1.0 (B:7-171) automated matches {Bacillus subtilis [TaxId: 1423]}
ldqikiayigggsqgwarslmsdlsidermsgtvalydldfeaaqknevignhsgngrwr
yeavstlkkalsaadiviisilpgslddmevdvhlpercgiyqsvgdtvgpggiirglra
vpifaeiarairdyapeswvinytnpmsvctrvlykvfpgikaig

SCOPe Domain Coordinates for d3fefb1:

Click to download the PDB-style file with coordinates for d3fefb1.
(The format of our PDB-style files is described here.)

Timeline for d3fefb1: