PDB entry 3fef

View 3fef on RCSB PDB site
Description: Crystal structure of putative glucosidase lplD from bacillus subtilis
Class: hydrolase
Keywords: lplD, gulosidase, structural genomics, UNKNOWN FUNCTION, Glycosidase, Hydrolase, Manganese, Metal-binding, NAD, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2008-11-28, released 2008-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative glucosidase lplD, ALPHA-GALACTURONIDASE
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU07130, lplD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fefa1, d3fefa2
  • Chain 'B':
    Compound: Putative glucosidase lplD, ALPHA-GALACTURONIDASE
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU07130, lplD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fefb1, d3fefb2
  • Chain 'C':
    Compound: Putative glucosidase lplD, ALPHA-GALACTURONIDASE
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU07130, lplD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fefc1, d3fefc2
  • Chain 'D':
    Compound: Putative glucosidase lplD, ALPHA-GALACTURONIDASE
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU07130, lplD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fefd1, d3fefd2
  • Heterogens: SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fefA (A:)
    msldqikiayigggsqgwarslmsdlsidermsgtvalydldfeaaqknevignhsgngr
    wryeavstlkkalsaadiviisilpgslddmevdvhlpercgiyqsvgdtvgpggiirgl
    ravpifaeiarairdyapeswvinytnpmsvctrvlykvfpgikaigcchevfgtqklla
    emvterlgievprredirvnvlginhftwitkasyrhidllpifrefsahygesgyeleg
    ecwrdsvfcsahrvafdlfetygaipaagdrhlaeflpgpylkqpevwkfhltpisfrkq
    draekrqeterlivqqrgvaekasgeegvniiaallglgelvtnvnmpnqgqvlnlpiqa
    ivetnafitrnrvqpilsgalpkgvemlaarhisnqeavadagltkdtglafqaflndpl
    vqidrsdaeqlfndmlqcimqseghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fefA (A:)
    ldqikiayigggsqgwarslmsdlsidermsgtvalydldfeaaqknevignhsgngrwr
    yeavstlkkalsaadiviisilpgslddmevdvhlpercgiyqsvgdtvgpggiirglra
    vpifaeiarairdyapeswvinytnpmsvctrvlykvfpgikaigcchevfgtqkllaem
    vterlgievprredirvnvlginhftwitkasyrhidllpifrefsahygesgyelegec
    wrdsvfcsahrvafdlfetygaipaagdrhlaeflpgpylkqpevwkfhltpisfrkqdr
    aekrqeterlivqqrgvaekasgeegvniiaallglgelvtnvnmpnqgqvlnlpiqaiv
    etnafitrnrvqpilsgalpkgvemlaarhisnqeavadagltkdtglafqaflndplvq
    idrsdaeqlfndml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fefB (B:)
    msldqikiayigggsqgwarslmsdlsidermsgtvalydldfeaaqknevignhsgngr
    wryeavstlkkalsaadiviisilpgslddmevdvhlpercgiyqsvgdtvgpggiirgl
    ravpifaeiarairdyapeswvinytnpmsvctrvlykvfpgikaigcchevfgtqklla
    emvterlgievprredirvnvlginhftwitkasyrhidllpifrefsahygesgyeleg
    ecwrdsvfcsahrvafdlfetygaipaagdrhlaeflpgpylkqpevwkfhltpisfrkq
    draekrqeterlivqqrgvaekasgeegvniiaallglgelvtnvnmpnqgqvlnlpiqa
    ivetnafitrnrvqpilsgalpkgvemlaarhisnqeavadagltkdtglafqaflndpl
    vqidrsdaeqlfndmlqcimqseghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fefB (B:)
    ldqikiayigggsqgwarslmsdlsidermsgtvalydldfeaaqknevignhsgngrwr
    yeavstlkkalsaadiviisilpgslddmevdvhlpercgiyqsvgdtvgpggiirglra
    vpifaeiarairdyapeswvinytnpmsvctrvlykvfpgikaigcchevfgtqkllaem
    vterlgievprredirvnvlginhftwitkasyrhidllpifrefsahygesgyelegec
    wrdsvfcsahrvafdlfetygaipaagdrhlaeflpgpylkqpevwkfhltpisfrkqdr
    aekrqeterlivqqrgvaekasgeegvniiaallglgelvtnvnmpnqgqvlnlpiqaiv
    etnafitrnrvqpilsgalpkgvemlaarhisnqeavadagltkdtglafqaflndplvq
    idrsdaeqlfndml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3fefC (C:)
    msldqikiayigggsqgwarslmsdlsidermsgtvalydldfeaaqknevignhsgngr
    wryeavstlkkalsaadiviisilpgslddmevdvhlpercgiyqsvgdtvgpggiirgl
    ravpifaeiarairdyapeswvinytnpmsvctrvlykvfpgikaigcchevfgtqklla
    emvterlgievprredirvnvlginhftwitkasyrhidllpifrefsahygesgyeleg
    ecwrdsvfcsahrvafdlfetygaipaagdrhlaeflpgpylkqpevwkfhltpisfrkq
    draekrqeterlivqqrgvaekasgeegvniiaallglgelvtnvnmpnqgqvlnlpiqa
    ivetnafitrnrvqpilsgalpkgvemlaarhisnqeavadagltkdtglafqaflndpl
    vqidrsdaeqlfndmlqcimqseghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fefC (C:)
    ldqikiayigggsqgwarslmsdlsidermsgtvalydldfeaaqknevignhsgngrwr
    yeavstlkkalsaadiviisilpgslddmevdvhlpercgiyqsvgdtvgpggiirglra
    vpifaeiarairdyapeswvinytnpmsvctrvlykvfpgikaigcchevfgtqkllaem
    vterlgievprredirvnvlginhftwitkasyrhidllpifrefsahygesgyelegec
    wrdsvfcsahrvafdlfetygaipaagdrhlaeflpgpylkqpevwkfhltpisfrkqdr
    aekrqeterlivqqrgvaekasgeegvniiaallglgelvtnvnmpnqgqvlnlpiqaiv
    etnafitrnrvqpilsgalpkgvemlaarhisnqeavadagltkdtglafqaflndplvq
    idrsdaeqlfndml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3fefD (D:)
    msldqikiayigggsqgwarslmsdlsidermsgtvalydldfeaaqknevignhsgngr
    wryeavstlkkalsaadiviisilpgslddmevdvhlpercgiyqsvgdtvgpggiirgl
    ravpifaeiarairdyapeswvinytnpmsvctrvlykvfpgikaigcchevfgtqklla
    emvterlgievprredirvnvlginhftwitkasyrhidllpifrefsahygesgyeleg
    ecwrdsvfcsahrvafdlfetygaipaagdrhlaeflpgpylkqpevwkfhltpisfrkq
    draekrqeterlivqqrgvaekasgeegvniiaallglgelvtnvnmpnqgqvlnlpiqa
    ivetnafitrnrvqpilsgalpkgvemlaarhisnqeavadagltkdtglafqaflndpl
    vqidrsdaeqlfndmlqcimqseghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fefD (D:)
    ldqikiayigggsqgwarslmsdlsidermsgtvalydldfeaaqknevignhsgngrwr
    yeavstlkkalsaadiviisilpgslddmevdvhlpercgiyqsvgdtvgpggiirglra
    vpifaeiarairdyapeswvinytnpmsvctrvlykvfpgikaigcchevfgtqkllaem
    vterlgievprredirvnvlginhftwitkasyrhidllpifrefsahygesgyelegec
    wrdsvfcsahrvafdlfetygaipaagdrhlaeflpgpylkqpevwkfhltpisfrkqdr
    aekrqeterlivqqrgvaekasgeegvniiaallglgelvtnvnmpnqgqvlnlpiqaiv
    etnafitrnrvqpilsgalpkgvemlaarhisnqeavadagltkdtglafqaflndplvq
    idrsdaeqlfndml