| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [196388] (13 PDB entries) |
| Domain d3fefa1: 3fef A:7-171 [209876] Other proteins in same PDB: d3fefa2, d3fefb2, d3fefc2, d3fefd2 automated match to d1obba1 complexed with mg, so4 |
PDB Entry: 3fef (more details), 2.2 Å
SCOPe Domain Sequences for d3fefa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fefa1 c.2.1.0 (A:7-171) automated matches {Bacillus subtilis [TaxId: 1423]}
ldqikiayigggsqgwarslmsdlsidermsgtvalydldfeaaqknevignhsgngrwr
yeavstlkkalsaadiviisilpgslddmevdvhlpercgiyqsvgdtvgpggiirglra
vpifaeiarairdyapeswvinytnpmsvctrvlykvfpgikaig
Timeline for d3fefa1: