Lineage for d3fefb2 (3fef B:172-440)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2557344Family d.162.1.2: AglA-like glucosidase [90050] (5 protein domains)
    family 4 glycosyl hydrolase
    automatically mapped to Pfam PF11975
  6. 2557384Protein automated matches [227094] (3 species)
    not a true protein
  7. 2557385Species Bacillus subtilis [TaxId:1423] [256397] (1 PDB entry)
  8. 2557387Domain d3fefb2: 3fef B:172-440 [239275]
    Other proteins in same PDB: d3fefa1, d3fefb1, d3fefc1, d3fefd1
    complexed with mg, so4

Details for d3fefb2

PDB Entry: 3fef (more details), 2.2 Å

PDB Description: crystal structure of putative glucosidase lpld from bacillus subtilis
PDB Compounds: (B:) Putative glucosidase lplD, ALPHA-GALACTURONIDASE

SCOPe Domain Sequences for d3fefb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fefb2 d.162.1.2 (B:172-440) automated matches {Bacillus subtilis [TaxId: 1423]}
cchevfgtqkllaemvterlgievprredirvnvlginhftwitkasyrhidllpifref
sahygesgyelegecwrdsvfcsahrvafdlfetygaipaagdrhlaeflpgpylkqpev
wkfhltpisfrkqdraekrqeterlivqqrgvaekasgeegvniiaallglgelvtnvnm
pnqgqvlnlpiqaivetnafitrnrvqpilsgalpkgvemlaarhisnqeavadagltkd
tglafqaflndplvqidrsdaeqlfndml

SCOPe Domain Coordinates for d3fefb2:

Click to download the PDB-style file with coordinates for d3fefb2.
(The format of our PDB-style files is described here.)

Timeline for d3fefb2: