Lineage for d3f12a1 (3f12 A:1-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743652Domain d3f12a1: 3f12 A:1-108 [209768]
    Other proteins in same PDB: d3f12a2, d3f12c2
    automated match to d1rhha1

Details for d3f12a1

PDB Entry: 3f12 (more details), 2.95 Å

PDB Description: Germline V-genes sculpt the binding site of a family of antibodies neutralizing human cytomegalovirus
PDB Compounds: (A:) M2J1 Fab

SCOPe Domain Sequences for d3f12a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f12a1 b.1.1.1 (A:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
rfsgsgsgtdftltisslepedfavyycqqrsnwppwtfgqgtkveik

SCOPe Domain Coordinates for d3f12a1:

Click to download the PDB-style file with coordinates for d3f12a1.
(The format of our PDB-style files is described here.)

Timeline for d3f12a1: