SCOPe 2.08: Domain d3f12c2: 3f12 C:110-214

Lineage for d3f12c2 (3f12 C:110-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3f12c2: 3f12 C:110-214 [209771]
   Other proteins in same PDB: d3f12a1, d3f12b_, d3f12c1, d3f12d_
   automated match to d1rhha2

Details for d3f12c2

PDB Entry: 3f12, 2.95 Å

PDB Description: Germline V-genes sculpt the binding site of a family of antibodies neutralizing human cytomegalovirus

PDB Compounds: (C:) M2J1 Fab

SCOPe Domain Sequences for d3f12c2:

Sequence; same for both SEQRES and ATOM records:

>d3f12c2 b.1.1.2 (C:110-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d3f12c2:

• d3f12c2 first appeared in SCOPe 2.03
  
• d3f12c2 appears in SCOPe 2.07