SCOPe 2.07: Domain d3f12a1: 3f12 A:1-108

Lineage for d3f12a1 (3f12 A:1-108)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)

8. Domain d3f12a1: 3f12 A:1-108 [209768]
   Other proteins in same PDB: d3f12a2, d3f12c2
   automated match to d1rhha1

Details for d3f12a1

PDB Entry: 3f12, 2.95 Å

PDB Description: Germline V-genes sculpt the binding site of a family of antibodies neutralizing human cytomegalovirus

PDB Compounds: (A:) M2J1 Fab

SCOPe Domain Sequences for d3f12a1:

Sequence; same for both SEQRES and ATOM records:

>d3f12a1 b.1.1.1 (A:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
rfsgsgsgtdftltisslepedfavyycqqrsnwppwtfgqgtkveik

Timeline for d3f12a1:

• d3f12a1 first appeared in SCOPe 2.03
  
• d3f12a1 appears in SCOPe 2.06
  
• d3f12a1 appears in the current release, SCOPe 2.08