Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
Protein automated matches [190646] (77 species) not a true protein |
Species Burkholderia thailandensis [TaxId:271848] [225530] (2 PDB entries) |
Domain d3egcb_: 3egc B: [209494] automated match to d2nzug_ |
PDB Entry: 3egc (more details), 2.35 Å
SCOPe Domain Sequences for d3egcb_:
Sequence, based on SEQRES records: (download)
>d3egcb_ c.93.1.0 (B:) automated matches {Burkholderia thailandensis [TaxId: 271848]} rsnvvglivsdienvffaevasgvesearhkgysvllantaedivrereavgqfferrvd glilapsegehdylrtelpktfpivavnrelripgcgavlsenvrgartaveyliarght rigaivgsaglmtsrerlkgfraamsaaglpvrqewiaaggvradngrdgaikvltgadr ptalltsshritegamqalnvlglrygpdveivsfdnlpwmafldpplpvveqptrrigq eamrmlihmiegtgnatemrlqtrfvth
>d3egcb_ c.93.1.0 (B:) automated matches {Burkholderia thailandensis [TaxId: 271848]} rsnvvglivsdienvffaevasgvesearhkgysvllantaedivrereavgqfferrvd glilapsegehdylrtelpktfpivavnrelripgcgavlsenvrgartaveyliarght rigaivgsaglmtsrerlkgfraamsaaglpvrqewiaangrdgaikvltgdrptallts shritegamqalnvlglrygpdveivsfdnlpwmafldpplpvveqptrrigqeamrmli hmiegtgnatemrlqtrfvth
Timeline for d3egcb_: