Lineage for d2nzug_ (2nzu G:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
parallel beta-sheet of 6 strands, order 213456Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) 
Similar in architecture to the superfamily II but partly differs in topologyFamily c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
has additional insertions and/or extensions that are not grouped together
Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (2 species) 
Species Bacillus megaterium [TaxId:1404] [117741] (10 PDB entries)
Uniprot P46828 58-322 ! Uniprot P46828
Domain d2nzug_: 2nzu G: [138854]
Other proteins in same PDB: d2nzul_
automated match to d1sxga_
complexed with bg6, so4
Details for d2nzug_
PDB Entry: 2nzu (more details), 2.5 Å
PDB Description: structural mechanism for the fine-tuning of ccpa function by the small molecule effectors g6p and fbp
PDB Compounds: (G:) Catabolite control proteinSCOPe Domain Sequences for d2nzug_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nzug_ c.93.1.1 (G:) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]}
kktttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqv
dgiifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsgh
kniafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleed
ekptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydi
gavamrlltkymnketvdssivqlphriefrqstk
SCOPe Domain Coordinates for d2nzug_:
Click to download the PDB-style file with coordinates for d2nzug_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2nzug_:
- d2nzug_ first appeared in SCOP 1.73, called d2nzug1
- d2nzug_ appears in SCOPe 2.07
View in 3D
