PDB entry 3egc

View 3egc on RCSB PDB site
Description: Crystal structure of a putative ribose operon repressor from Burkholderia thailandensis
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, DNA-binding, Transcription, Transcription regulation, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2008-09-10, released 2008-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative ribose operon repressor
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I0812
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3egca_
  • Chain 'B':
    Compound: putative ribose operon repressor
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I0812
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3egcb_
  • Chain 'C':
    Compound: putative ribose operon repressor
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I0812
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3egcc_
  • Chain 'D':
    Compound: putative ribose operon repressor
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I0812
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3egcd_
  • Chain 'E':
    Compound: putative ribose operon repressor
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I0812
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3egce_
  • Chain 'F':
    Compound: putative ribose operon repressor
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I0812
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3egcf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3egcA (A:)
    mslrskrsnvvglivsdienvffaevasgvesearhkgysvllantaedivrereavgqf
    ferrvdglilapsegehdylrtelpktfpivavnrelripgcgavlsenvrgartaveyl
    iarghtrigaivgsaglmtsrerlkgfraamsaaglpvrqewiaaggvradngrdgaikv
    ltgadrptalltsshritegamqalnvlglrygpdveivsfdnlpwmafldpplpvveqp
    trrigqeamrmlihmiegtgnatemrlqtrfvthvgqdlsveaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3egcA (A:)
    rsnvvglivsdienvffaevasgvesearhkgysvllantaedivrereavgqfferrvd
    glilapsegehdylrtelpktfpivavnrelripgcgavlsenvrgartaveyliarght
    rigaivgsaglmtsrerlkgfraamsaaglpvrqewiaangrdgaikvltgdrptallts
    shritegamqalnvlglrygpdveivsfdnlpwmafldpplpvveqptrrigqeamrmli
    hmiegtgnatemrlqtrfvth
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3egcB (B:)
    mslrskrsnvvglivsdienvffaevasgvesearhkgysvllantaedivrereavgqf
    ferrvdglilapsegehdylrtelpktfpivavnrelripgcgavlsenvrgartaveyl
    iarghtrigaivgsaglmtsrerlkgfraamsaaglpvrqewiaaggvradngrdgaikv
    ltgadrptalltsshritegamqalnvlglrygpdveivsfdnlpwmafldpplpvveqp
    trrigqeamrmlihmiegtgnatemrlqtrfvthvgqdlsveaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3egcB (B:)
    rsnvvglivsdienvffaevasgvesearhkgysvllantaedivrereavgqfferrvd
    glilapsegehdylrtelpktfpivavnrelripgcgavlsenvrgartaveyliarght
    rigaivgsaglmtsrerlkgfraamsaaglpvrqewiaangrdgaikvltgdrptallts
    shritegamqalnvlglrygpdveivsfdnlpwmafldpplpvveqptrrigqeamrmli
    hmiegtgnatemrlqtrfvth
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3egcC (C:)
    mslrskrsnvvglivsdienvffaevasgvesearhkgysvllantaedivrereavgqf
    ferrvdglilapsegehdylrtelpktfpivavnrelripgcgavlsenvrgartaveyl
    iarghtrigaivgsaglmtsrerlkgfraamsaaglpvrqewiaaggvradngrdgaikv
    ltgadrptalltsshritegamqalnvlglrygpdveivsfdnlpwmafldpplpvveqp
    trrigqeamrmlihmiegtgnatemrlqtrfvthvgqdlsveaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3egcC (C:)
    rsnvvglivsdienvffaevasgvesearhkgysvllantaedivrereavgqfferrvd
    glilapsegehdylrtelpktfpivavnrelripgcgavlsenvrgartaveyliarght
    rigaivgsaglmtsrerlkgfraamsaaglpvrqewiaangrdgaikvltgdrptallts
    shritegamqalnvlglrygpdveivsfdnlpwmafldpplpvveqptrrigqeamrmli
    hmiegtgnatemrlqtrfvth
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3egcD (D:)
    mslrskrsnvvglivsdienvffaevasgvesearhkgysvllantaedivrereavgqf
    ferrvdglilapsegehdylrtelpktfpivavnrelripgcgavlsenvrgartaveyl
    iarghtrigaivgsaglmtsrerlkgfraamsaaglpvrqewiaaggvradngrdgaikv
    ltgadrptalltsshritegamqalnvlglrygpdveivsfdnlpwmafldpplpvveqp
    trrigqeamrmlihmiegtgnatemrlqtrfvthvgqdlsveaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3egcD (D:)
    rsnvvglivsdienvffaevasgvesearhkgysvllantaedivrereavgqfferrvd
    glilapsegehdylrtelpktfpivavnrelripgcgavlsenvrgartaveyliarght
    rigaivgsaglmtsrerlkgfraamsaaglpvrqewiaangrdgaikvltgadrptallt
    sshritegamqalnvlglrygpdveivsfdnlpwmafldpplpvveqptrrigqeamrml
    ihmiegtgnatemrlqtrfvth
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3egcE (E:)
    mslrskrsnvvglivsdienvffaevasgvesearhkgysvllantaedivrereavgqf
    ferrvdglilapsegehdylrtelpktfpivavnrelripgcgavlsenvrgartaveyl
    iarghtrigaivgsaglmtsrerlkgfraamsaaglpvrqewiaaggvradngrdgaikv
    ltgadrptalltsshritegamqalnvlglrygpdveivsfdnlpwmafldpplpvveqp
    trrigqeamrmlihmiegtgnatemrlqtrfvthvgqdlsveaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3egcE (E:)
    rsnvvglivsdienvffaevasgvesearhkgysvllantaedivrereavgqfferrvd
    glilapsegehdylrtelpktfpivavnrelripgcgavlsenvrgartaveyliarght
    rigaivgsaglmtsrerlkgfraamsaaglpvrqewiaangrdgaikvltgdrptallts
    shritegamqalnvlglrygpdveivsfdnlpwmafldpplpvveqptrrigqeamrmli
    hmiegtgnatemrlqtrfvth
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3egcF (F:)
    mslrskrsnvvglivsdienvffaevasgvesearhkgysvllantaedivrereavgqf
    ferrvdglilapsegehdylrtelpktfpivavnrelripgcgavlsenvrgartaveyl
    iarghtrigaivgsaglmtsrerlkgfraamsaaglpvrqewiaaggvradngrdgaikv
    ltgadrptalltsshritegamqalnvlglrygpdveivsfdnlpwmafldpplpvveqp
    trrigqeamrmlihmiegtgnatemrlqtrfvthvgqdlsveaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3egcF (F:)
    rsnvvglivsdienvffaevasgvesearhkgysvllantaedivrereavgqfferrvd
    glilapsegehdylrtelpktfpivavnrelripgcgavlsenvrgartaveyliarght
    rigaivgsaglmtsrerlkgfraamsaaglpvrqewiaangrdgaikvltgadrptallt
    sshritegamqalnvlglrygpdveivsfdnlpwmafldpplpvveqptrrigqeamrml
    ihmiegtgnatemrlqtrfvth