Lineage for d3egca_ (3egc A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143989Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2143990Protein automated matches [190646] (70 species)
    not a true protein
  7. 2144076Species Burkholderia thailandensis [TaxId:271848] [225530] (2 PDB entries)
  8. 2144078Domain d3egca_: 3egc A: [209493]
    automated match to d2nzug_

Details for d3egca_

PDB Entry: 3egc (more details), 2.35 Å

PDB Description: crystal structure of a putative ribose operon repressor from burkholderia thailandensis
PDB Compounds: (A:) putative ribose operon repressor

SCOPe Domain Sequences for d3egca_:

Sequence, based on SEQRES records: (download)

>d3egca_ c.93.1.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
rsnvvglivsdienvffaevasgvesearhkgysvllantaedivrereavgqfferrvd
glilapsegehdylrtelpktfpivavnrelripgcgavlsenvrgartaveyliarght
rigaivgsaglmtsrerlkgfraamsaaglpvrqewiaaggvradngrdgaikvltgadr
ptalltsshritegamqalnvlglrygpdveivsfdnlpwmafldpplpvveqptrrigq
eamrmlihmiegtgnatemrlqtrfvth

Sequence, based on observed residues (ATOM records): (download)

>d3egca_ c.93.1.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
rsnvvglivsdienvffaevasgvesearhkgysvllantaedivrereavgqfferrvd
glilapsegehdylrtelpktfpivavnrelripgcgavlsenvrgartaveyliarght
rigaivgsaglmtsrerlkgfraamsaaglpvrqewiaangrdgaikvltgdrptallts
shritegamqalnvlglrygpdveivsfdnlpwmafldpplpvveqptrrigqeamrmli
hmiegtgnatemrlqtrfvth

SCOPe Domain Coordinates for d3egca_:

Click to download the PDB-style file with coordinates for d3egca_.
(The format of our PDB-style files is described here.)

Timeline for d3egca_: