Lineage for d3cwvb1 (3cwv B:10-206)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1429695Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1429696Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1430131Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 1430132Protein automated matches [226867] (10 species)
    not a true protein
  7. 1430181Species Myxococcus xanthus [TaxId:246197] [225452] (1 PDB entry)
  8. 1430183Domain d3cwvb1: 3cwv B:10-206 [208974]
    Other proteins in same PDB: d3cwva2, d3cwvb2
    automated match to d1ei1a2

Details for d3cwvb1

PDB Entry: 3cwv (more details), 1.95 Å

PDB Description: crystal structure of b-subunit of the dna gyrase from myxococcus xanthus
PDB Compounds: (B:) DNA gyrase, B subunit, truncated

SCOPe Domain Sequences for d3cwvb1:

Sequence, based on SEQRES records: (download)

>d3cwvb1 d.122.1.0 (B:10-206) automated matches {Myxococcus xanthus [TaxId: 246197]}
ivenvrkrpgmycgdvgeyglhhlvyflldvayeearrgecrdvvlevggdgsialfcts
rtvtaenlvrvatgagflgrppgdgwgwdsmlvvslalssryqvdiwadgrqwrvmgehg
hpqgegaavtpmepmpvsaergvrvhfvpdatifevlafdrarlsrrcnelaalapglrv
sfadlqrgertlwhlpg

Sequence, based on observed residues (ATOM records): (download)

>d3cwvb1 d.122.1.0 (B:10-206) automated matches {Myxococcus xanthus [TaxId: 246197]}
ivenvrkrpgmycgdvgeyglhhlvyflldvayeearrgecrdvvlevggdgsialfcts
smlvvslalssryqvdiwdgrqwrvmgehghpqgmepmpvsaergvrvhfvpdatifevl
afdrarlsrrcnelaalapglrvsfadlqrgertlwhlpg

SCOPe Domain Coordinates for d3cwvb1:

Click to download the PDB-style file with coordinates for d3cwvb1.
(The format of our PDB-style files is described here.)

Timeline for d3cwvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cwvb2