Lineage for d3cwva2 (3cwv A:207-356)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1401399Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1401400Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1402062Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 1402063Protein automated matches [190826] (13 species)
    not a true protein
  7. 1402126Species Myxococcus xanthus [TaxId:246197] [225453] (1 PDB entry)
  8. 1402127Domain d3cwva2: 3cwv A:207-356 [208973]
    Other proteins in same PDB: d3cwva1, d3cwvb1
    automated match to d1ei1a1

Details for d3cwva2

PDB Entry: 3cwv (more details), 1.95 Å

PDB Description: crystal structure of b-subunit of the dna gyrase from myxococcus xanthus
PDB Compounds: (A:) DNA gyrase, B subunit, truncated

SCOPe Domain Sequences for d3cwva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cwva2 d.14.1.0 (A:207-356) automated matches {Myxococcus xanthus [TaxId: 246197]}
gvaqwahvltearpqlhpepvvfdftwdglrvqcalqwcededstllsfanavrtvrhga
hvkgvtqalrgalaklsgetrgafpwarvaqgltaivavsgprrqmafagptkellaipg
leeairkqlqplfiellrehpvtpallarr

SCOPe Domain Coordinates for d3cwva2:

Click to download the PDB-style file with coordinates for d3cwva2.
(The format of our PDB-style files is described here.)

Timeline for d3cwva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cwva1