Lineage for d1ei1a2 (1ei1 A:2-220)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
8-stranded mixed beta-sheet; 2 layers: alpha/betaSuperfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) 
Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins) 
Protein DNA gyrase B [55880] (2 species) Species Escherichia coli [TaxId:562] [55881] (3 PDB entries) 
Domain d1ei1a2: 1ei1 A:2-220 [41104]
Other proteins in same PDB: d1ei1a1, d1ei1b1
complexed with anp, gol, so4
Details for d1ei1a2
PDB Entry: 1ei1 (more details), 2.3 Å
PDB Description: dimerization of e. coli dna gyrase b provides a structural mechanism for activating the atpase catalytic center
PDB Compounds: (A:) DNA gyrase bSCOPe Domain Sequences for d1ei1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ei1a2 d.122.1.2 (A:2-220) DNA gyrase B {Escherichia coli [TaxId: 562]}
snssdsssikvlkgldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiiv
tihadnsvsvqddgrgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvs
vvnalsqklelviqregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvte
feyeilakrlrelsfldsgvsirlrdkrdgkedhfhyeg
SCOPe Domain Coordinates for d1ei1a2:
Click to download the PDB-style file with coordinates for d1ei1a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ei1a2:
- d1ei1a2 first appeared (with stable ids) in SCOP 1.55
- d1ei1a2 appears in SCOPe 2.02
- d1ei1a2 appears in SCOPe 2.04
- d1ei1a2 appears in the current release, SCOPe 2.08
View in 3D
