SCOPe 2.03: Domain d3cwvb2: 3cwv B:207-357

Lineage for d3cwvb2 (3cwv B:207-357)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (13 species)
   not a true protein

7. Species Myxococcus xanthus [TaxId:246197] [225453] (1 PDB entry)

8. Domain d3cwvb2: 3cwv B:207-357 [208975]
   Other proteins in same PDB: d3cwva1, d3cwvb1
   automated match to d1ei1a1

Details for d3cwvb2

PDB Entry: 3cwv, 1.95 Å

PDB Description: crystal structure of b-subunit of the dna gyrase from myxococcus xanthus

PDB Compounds: (B:) DNA gyrase, B subunit, truncated

SCOPe Domain Sequences for d3cwvb2:

Sequence; same for both SEQRES and ATOM records:

>d3cwvb2 d.14.1.0 (B:207-357) automated matches {Myxococcus xanthus [TaxId: 246197]}
gvaqwahvltearpqlhpepvvfdftwdglrvqcalqwcededstllsfanavrtvrhga
hvkgvtqalrgalaklsgetrgafpwarvaqgltaivavsgprrqmafagptkellaipg
leeairkqlqplfiellrehpvtpallarrt

Timeline for d3cwvb2:

• d3cwvb2 is new in SCOPe 2.03-stable
  
• d3cwvb2 appears in SCOPe 2.04
  
• d3cwvb2 appears in the current release, SCOPe 2.08