Lineage for d3co7c_ (3co7 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693299Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins)
  6. 2693320Protein automated matches [190243] (2 species)
    not a true protein
  7. 2693321Species Human (Homo sapiens) [TaxId:9606] [187016] (11 PDB entries)
  8. 2693336Domain d3co7c_: 3co7 C: [208912]
    automated match to d1e17a_
    protein/DNA complex

Details for d3co7c_

PDB Entry: 3co7 (more details), 2.91 Å

PDB Description: crystal structure of foxo1 dbd bound to dbe2 dna
PDB Compounds: (C:) Forkhead box protein O1

SCOPe Domain Sequences for d3co7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3co7c_ a.4.5.14 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srrnawgnlsyadlitkaiessaekrltlsqiyewmvksvpyfkdkgdsnssagwknsir
hnlslhskfirvqnegtgksswwmlnp

SCOPe Domain Coordinates for d3co7c_:

Click to download the PDB-style file with coordinates for d3co7c_.
(The format of our PDB-style files is described here.)

Timeline for d3co7c_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3co7f_