Lineage for d1e17a_ (1e17 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693299Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins)
  6. 2693303Protein Afx (Foxo4) [46833] (1 species)
  7. 2693304Species Human (Homo sapiens) [TaxId:9606] [46834] (2 PDB entries)
  8. 2693306Domain d1e17a_: 1e17 A: [16143]

Details for d1e17a_

PDB Entry: 1e17 (more details)

PDB Description: solution structure of the dna binding domain of the human forkhead transcription factor afx (foxo4)
PDB Compounds: (A:) afx

SCOPe Domain Sequences for d1e17a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e17a_ a.4.5.14 (A:) Afx (Foxo4) {Human (Homo sapiens) [TaxId: 9606]}
srrnawgnqsyaelisqaiesapekrltlaqiyewmvrtvpyfkdkgdsnssagwknsir
hnlslhskfikvhneatgksswwmlnpegg

SCOPe Domain Coordinates for d1e17a_:

Click to download the PDB-style file with coordinates for d1e17a_.
(The format of our PDB-style files is described here.)

Timeline for d1e17a_: