SCOPe 2.08: Domain d3co7f_: 3co7 F:

Lineage for d3co7f_ (3co7 F:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins)

6. Protein automated matches [190243] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187016] (11 PDB entries)

8. Domain d3co7f_: 3co7 F: [208913]
   automated match to d1e17a_
   protein/DNA complex

Details for d3co7f_

PDB Entry: 3co7, 2.91 Å

PDB Description: crystal structure of foxo1 dbd bound to dbe2 dna

PDB Compounds: (F:) Forkhead box protein O1

SCOPe Domain Sequences for d3co7f_:

Sequence; same for both SEQRES and ATOM records:

>d3co7f_ a.4.5.14 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srrnawgnlsyadlitkaiessaekrltlsqiyewmvksvpyfkdkgdsnssagwknsir
hnlslhskfirvqnegtgksswwmlnp

Timeline for d3co7f_:

• d3co7f_ first appeared in SCOPe 2.03
  
• d3co7f_ appears in SCOPe 2.07