SCOPe 2.08: Domain d3b7qb1: 3b7q B:3-94

Lineage for d3b7qb1 (3b7q B:3-94)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families)

5. Family a.5.3.0: automated matches [227224] (1 protein)
   not a true family

6. Protein automated matches [226965] (4 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225408] (5 PDB entries)

8. Domain d3b7qb1: 3b7q B:3-94 [208553]
   Other proteins in same PDB: d3b7qa2, d3b7qb2
   automated match to d1auaa1
   complexed with 6pl, gol, po4

Details for d3b7qb1

PDB Entry: 3b7q, 2.03 Å

PDB Description: crystal structure of yeast sec14 homolog sfh1 in complex with phosphatidylcholine

PDB Compounds: (B:) Uncharacterized protein YKL091C

SCOPe Domain Sequences for d3b7qb1:

Sequence; same for both SEQRES and ATOM records:

>d3b7qb1 a.5.3.0 (B:3-94) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tsildtypqicspnalpgtpgnltkeqeeallqfrsilleknykerlddstllrflrark
fdinasvemfveterwreeygantiiedyenn

Timeline for d3b7qb1:

• d3b7qb1 first appeared in SCOPe 2.03
  
• d3b7qb1 appears in SCOPe 2.07