| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families) ![]() |
| Family a.5.3.0: automated matches [227224] (1 protein) not a true family |
| Protein automated matches [226965] (4 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225408] (5 PDB entries) |
| Domain d3b7qb1: 3b7q B:3-94 [208553] Other proteins in same PDB: d3b7qa2, d3b7qb2 automated match to d1auaa1 complexed with 6pl, gol, po4 |
PDB Entry: 3b7q (more details), 2.03 Å
SCOPe Domain Sequences for d3b7qb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b7qb1 a.5.3.0 (B:3-94) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tsildtypqicspnalpgtpgnltkeqeeallqfrsilleknykerlddstllrflrark
fdinasvemfveterwreeygantiiedyenn
Timeline for d3b7qb1: