SCOPe 2.08: Domain d3b7qa2: 3b7q A:95-310

Lineage for d3b7qa2 (3b7q A:95-310)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
   core: 4 turns of a (beta-alpha)n superhelix

4. Superfamily c.13.1: CRAL/TRIO domain [52087] (2 families)
   automatically mapped to Pfam PF00650

5. Family c.13.1.0: automated matches [227225] (1 protein)
   not a true family

6. Protein automated matches [226966] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225409] (5 PDB entries)

8. Domain d3b7qa2: 3b7q A:95-310 [208552]
   Other proteins in same PDB: d3b7qa1, d3b7qb1
   automated match to d1auaa2
   complexed with 6pl, gol, po4

Details for d3b7qa2

PDB Entry: 3b7q, 2.03 Å

PDB Description: crystal structure of yeast sec14 homolog sfh1 in complex with phosphatidylcholine

PDB Compounds: (A:) Uncharacterized protein YKL091C

SCOPe Domain Sequences for d3b7qa2:

Sequence; same for both SEQRES and ATOM records:

>d3b7qa2 c.13.1.0 (A:95-310) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
keaedkeriklakmypqyyhhvdkdgrplyfeelgginlkkmykittekqmlrnlvkeye
lfatyrvpacsrragylietsctvldlkgislsnayhvlsyikdvadisqnyypermgkf
yiihspfgfstmfkmvkpfldpvtvskifilgssykkellkqipienlpvkyggtsvlhn
pndkfyysdigpwrdpryigpegeipnifgkftvts

Timeline for d3b7qa2:

• d3b7qa2 first appeared in SCOPe 2.03
  
• d3b7qa2 appears in SCOPe 2.07