Lineage for d3b7qb1 (3b7q B:3-94)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1260917Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1261102Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families) (S)
  5. 1261121Family a.5.3.0: automated matches [227224] (1 protein)
    not a true family
  6. 1261122Protein automated matches [226965] (2 species)
    not a true protein
  7. 1261123Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225408] (5 PDB entries)
  8. 1261128Domain d3b7qb1: 3b7q B:3-94 [208553]
    Other proteins in same PDB: d3b7qa2, d3b7qb2
    automated match to d1auaa1
    complexed with 6pl, gol, po4

Details for d3b7qb1

PDB Entry: 3b7q (more details), 2.03 Å

PDB Description: crystal structure of yeast sec14 homolog sfh1 in complex with phosphatidylcholine
PDB Compounds: (B:) Uncharacterized protein YKL091C

SCOPe Domain Sequences for d3b7qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b7qb1 a.5.3.0 (B:3-94) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tsildtypqicspnalpgtpgnltkeqeeallqfrsilleknykerlddstllrflrark
fdinasvemfveterwreeygantiiedyenn

SCOPe Domain Coordinates for d3b7qb1:

Click to download the PDB-style file with coordinates for d3b7qb1.
(The format of our PDB-style files is described here.)

Timeline for d3b7qb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3b7qb2