| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
| Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
| Protein Lactate dehydrogenase [56339] (19 species) |
| Species Lactobacillus casei [TaxId:1582] [56345] (6 PDB entries) |
| Domain d2zqya2: 2zqy A:163-329 [207942] Other proteins in same PDB: d2zqya1, d2zqyb1, d2zqyc1, d2zqyd1 automated match to d1llca2 complexed with no3 |
PDB Entry: 2zqy (more details), 2.6 Å
SCOPe Domain Sequences for d2zqya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zqya2 d.162.1.1 (A:163-329) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
tsldtarfrqsiaemvnvdarsvhayimgehgdtefpvwshaniggvtiaewvkahpeik
edklvkmfedvrdaayeiiklkgatfygiatalariskailndenavlplsvymdgqygl
ndiyigtpavinrngiqnileipltdheeesmqksasqlkkvltdaf
Timeline for d2zqya2: