SCOPe 2.07: Domain d2zqya2: 2zqy A:163-329

Lineage for d2zqya2 (2zqy A:163-329)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Lactate dehydrogenase [56339] (20 species)

7. Species Lactobacillus casei [TaxId:1582] [56345] (7 PDB entries)

8. Domain d2zqya2: 2zqy A:163-329 [207942]
   Other proteins in same PDB: d2zqya1, d2zqyb1, d2zqyc1, d2zqyd1
   automated match to d1llca2
   complexed with no3

Details for d2zqya2

PDB Entry: 2zqy, 2.6 Å

PDB Description: T-state structure of allosteric L-lactate dehydrogenase from Lactobacillus casei

PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2zqya2:

Sequence; same for both SEQRES and ATOM records:

>d2zqya2 d.162.1.1 (A:163-329) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
tsldtarfrqsiaemvnvdarsvhayimgehgdtefpvwshaniggvtiaewvkahpeik
edklvkmfedvrdaayeiiklkgatfygiatalariskailndenavlplsvymdgqygl
ndiyigtpavinrngiqnileipltdheeesmqksasqlkkvltdaf

Timeline for d2zqya2:

• d2zqya2 first appeared in SCOPe 2.03
  
• d2zqya2 appears in SCOPe 2.06
  
• d2zqya2 appears in the current release, SCOPe 2.08