Lineage for d2zqya1 (2zqy A:21-162)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2105555Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2105594Protein Lactate dehydrogenase [51859] (18 species)
  7. 2105737Species Lactobacillus casei [TaxId:1582] [51865] (6 PDB entries)
  8. 2105750Domain d2zqya1: 2zqy A:21-162 [207941]
    Other proteins in same PDB: d2zqya2, d2zqyb2, d2zqyc2, d2zqyd2
    automated match to d1llca1
    complexed with no3

Details for d2zqya1

PDB Entry: 2zqy (more details), 2.6 Å

PDB Description: T-state structure of allosteric L-lactate dehydrogenase from Lactobacillus casei
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2zqya1:

Sequence, based on SEQRES records: (download)

>d2zqya1 c.2.1.5 (A:21-162) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
qkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkkiysa
eysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflvaanpvd
iltyatwklsgfpknrvvgsg

Sequence, based on observed residues (ATOM records): (download)

>d2zqya1 c.2.1.5 (A:21-162) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
qkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkkiysa
eysdakdadlvvitagapgetrldlvnknlkilksivdpivdsgfngiflvaanpvdilt
yatwklsgfpknrvvgsg

SCOPe Domain Coordinates for d2zqya1:

Click to download the PDB-style file with coordinates for d2zqya1.
(The format of our PDB-style files is described here.)

Timeline for d2zqya1: