| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
| Protein Lactate dehydrogenase [51859] (18 species) |
| Species Lactobacillus casei [TaxId:1582] [51865] (6 PDB entries) |
| Domain d2zqyb1: 2zqy B:21-162 [207943] Other proteins in same PDB: d2zqya2, d2zqyb2, d2zqyc2, d2zqyd2 automated match to d1llca1 complexed with no3 |
PDB Entry: 2zqy (more details), 2.6 Å
SCOPe Domain Sequences for d2zqyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zqyb1 c.2.1.5 (B:21-162) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
qkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkkiysa
eysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflvaanpvd
iltyatwklsgfpknrvvgsg
Timeline for d2zqyb1: