Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) contains extra C-terminal strand 5, order 21345 |
Family c.97.1.0: automated matches [191471] (1 protein) not a true family |
Protein automated matches [190746] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225587] (2 PDB entries) |
Domain d2w4le_: 2w4l E: [206622] automated match to d1vq2a_ complexed with cl, zn |
PDB Entry: 2w4l (more details), 2.1 Å
SCOPe Domain Sequences for d2w4le_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w4le_ c.97.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ylewpeyfmavaflsaqrskdpnsqvgacivnsenkivgigyngmpngcsddvlpwrrta enkldtkypyvchaelnaimnknltdvkgcsmyvalfpcnecakliiqagikevifmsdk yhdsdeataarllfnmagvtfrkfipkcskividfdsinsrp
Timeline for d2w4le_: