SCOPe 2.07: Domain d2w4le_: 2w4l E:

Lineage for d2w4le_ (2w4l E:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.0: automated matches [191471] (1 protein)
   not a true family

6. Protein automated matches [190746] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225587] (2 PDB entries)

8. Domain d2w4le_: 2w4l E: [206622]
   automated match to d1vq2a_
   complexed with cl, zn

Details for d2w4le_

PDB Entry: 2w4l, 2.1 Å

PDB Description: human dcmp deaminase

PDB Compounds: (E:) deoxycytidylate deaminase

SCOPe Domain Sequences for d2w4le_:

Sequence; same for both SEQRES and ATOM records:

>d2w4le_ c.97.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ylewpeyfmavaflsaqrskdpnsqvgacivnsenkivgigyngmpngcsddvlpwrrta
enkldtkypyvchaelnaimnknltdvkgcsmyvalfpcnecakliiqagikevifmsdk
yhdsdeataarllfnmagvtfrkfipkcskividfdsinsrp

Timeline for d2w4le_:

• d2w4le_ first appeared in SCOPe 2.03
  
• d2w4le_ appears in SCOPe 2.06
  
• d2w4le_ appears in the current release, SCOPe 2.08