Lineage for d2w4ld_ (2w4l D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2525733Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2525734Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2526065Family c.97.1.0: automated matches [191471] (1 protein)
    not a true family
  6. 2526066Protein automated matches [190746] (16 species)
    not a true protein
  7. 2526089Species Human (Homo sapiens) [TaxId:9606] [225587] (2 PDB entries)
  8. 2526093Domain d2w4ld_: 2w4l D: [206621]
    automated match to d1vq2a_
    complexed with cl, zn

Details for d2w4ld_

PDB Entry: 2w4l (more details), 2.1 Å

PDB Description: human dcmp deaminase
PDB Compounds: (D:) deoxycytidylate deaminase

SCOPe Domain Sequences for d2w4ld_:

Sequence, based on SEQRES records: (download)

>d2w4ld_ c.97.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dylewpeyfmavaflsaqrskdpnsqvgacivnsenkivgigyngmpngcsddvlpwrrt
aenkldtkypyvchaelnaimnknltdvkgcsmyvalfpcnecakliiqagikevifmsd
kyhdsdeataarllfnmagvtfrkfipkcskividfdsi

Sequence, based on observed residues (ATOM records): (download)

>d2w4ld_ c.97.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dylewpeyfmavaflsaqrskdpnsqvgacivnsenkivgigyngmpngcvlpwrrtaen
ktkypyvchaelnaimnkvkgcsmyvalfpcnecakliiqagikevifmsdkyhdsdeat
aarllfnmagvtfrkfipkcskividfdsi

SCOPe Domain Coordinates for d2w4ld_:

Click to download the PDB-style file with coordinates for d2w4ld_.
(The format of our PDB-style files is described here.)

Timeline for d2w4ld_: