SCOPe 2.08: Domain d2vofc1: 2vof C:1-149

Lineage for d2vofc1 (2vof C:1-149)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.0: automated matches [195065] (1 protein)
   not a true family

6. Protein automated matches [195066] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [195067] (5 PDB entries)

8. Domain d2vofc1: 2vof C:1-149 [206402]
   Other proteins in same PDB: d2vofa2, d2vofc2
   automated match to d2voia_
   complexed with cl

Details for d2vofc1

PDB Entry: 2vof, 1.8 Å

PDB Description: structure of mouse a1 bound to the puma bh3-domain

PDB Compounds: (C:) bcl-2-related protein a1

SCOPe Domain Sequences for d2vofc1:

Sequence, based on SEQRES records:

>d2vofc1 f.1.4.0 (C:1-149) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
maeselmhihslaehylqyvlqvpafesapsqacrvlqrvafsvqkeveknlksylddfh
vesidtariifnqvmekefedgiinwgrivtifafggvllkklkqeqialdvsaykqvss
fvaefimnntgewirqnggwedgfikkfe

Sequence, based on observed residues (ATOM records):

>d2vofc1 f.1.4.0 (C:1-149) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
maeselmhihslaehylqyvlqvpafepsqacrvlqrvafsvqkeveknlksylddfhve
sidtariifnqvmekefedgiinwgrivtifafggvllkklkqeqialdvsaykqvssfv
aefimnntgewirqnggwedgfikkfe

Timeline for d2vofc1:

• d2vofc1 first appeared in SCOPe 2.03, called d2vofc_
  
• d2vofc1 appears in SCOPe 2.07