Lineage for d2vofa1 (2vof A:1-150)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021129Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 3021541Family f.1.4.0: automated matches [195065] (1 protein)
    not a true family
  6. 3021542Protein automated matches [195066] (5 species)
    not a true protein
  7. 3021572Species Mouse (Mus musculus) [TaxId:10090] [195067] (5 PDB entries)
  8. 3021573Domain d2vofa1: 2vof A:1-150 [206401]
    Other proteins in same PDB: d2vofa2, d2vofc2
    automated match to d2voia_
    complexed with cl

Details for d2vofa1

PDB Entry: 2vof (more details), 1.8 Å

PDB Description: structure of mouse a1 bound to the puma bh3-domain
PDB Compounds: (A:) bcl-2-related protein a1

SCOPe Domain Sequences for d2vofa1:

Sequence, based on SEQRES records: (download)

>d2vofa1 f.1.4.0 (A:1-150) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
maeselmhihslaehylqyvlqvpafesapsqacrvlqrvafsvqkeveknlksylddfh
vesidtariifnqvmekefedgiinwgrivtifafggvllkklkqeqialdvsaykqvss
fvaefimnntgewirqnggwedgfikkfep

Sequence, based on observed residues (ATOM records): (download)

>d2vofa1 f.1.4.0 (A:1-150) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
maeselmhihslaehylqyvlqvpafeapsqacrvlqrvafsvqkeveknlksylddfhv
esidtariifnqvmekefedgiinwgrivtifafggvllkklkqesaykqvssfvaefim
nntgewirqnggwedgfikkfep

SCOPe Domain Coordinates for d2vofa1:

Click to download the PDB-style file with coordinates for d2vofa1.
(The format of our PDB-style files is described here.)

Timeline for d2vofa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vofa2