![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
![]() | Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) ![]() PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
![]() | Family f.1.4.0: automated matches [195065] (1 protein) not a true family |
![]() | Protein automated matches [195066] (5 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [195067] (5 PDB entries) |
![]() | Domain d2vofa1: 2vof A:1-150 [206401] Other proteins in same PDB: d2vofa2, d2vofc2 automated match to d2voia_ complexed with cl |
PDB Entry: 2vof (more details), 1.8 Å
SCOPe Domain Sequences for d2vofa1:
Sequence, based on SEQRES records: (download)
>d2vofa1 f.1.4.0 (A:1-150) automated matches {Mouse (Mus musculus) [TaxId: 10090]} maeselmhihslaehylqyvlqvpafesapsqacrvlqrvafsvqkeveknlksylddfh vesidtariifnqvmekefedgiinwgrivtifafggvllkklkqeqialdvsaykqvss fvaefimnntgewirqnggwedgfikkfep
>d2vofa1 f.1.4.0 (A:1-150) automated matches {Mouse (Mus musculus) [TaxId: 10090]} maeselmhihslaehylqyvlqvpafeapsqacrvlqrvafsvqkeveknlksylddfhv esidtariifnqvmekefedgiinwgrivtifafggvllkklkqesaykqvssfvaefim nntgewirqnggwedgfikkfep
Timeline for d2vofa1: