Lineage for d2vcvi1 (2vcv I:4-80)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1602360Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1602361Protein automated matches [190056] (133 species)
    not a true protein
  7. 1602752Species Human (Homo sapiens) [TaxId:9606] [188013] (91 PDB entries)
  8. 1602826Domain d2vcvi1: 2vcv I:4-80 [206316]
    Other proteins in same PDB: d2vcva2, d2vcvb2, d2vcvc2, d2vcvd2, d2vcve2, d2vcvf2, d2vcvg2, d2vcvh2, d2vcvi2, d2vcvj2, d2vcvk2, d2vcvl2, d2vcvm2, d2vcvn2, d2vcvo2, d2vcvp2
    automated match to d1k3ya2
    complexed with asd, gsh

Details for d2vcvi1

PDB Entry: 2vcv (more details), 1.8 Å

PDB Description: glutathione transferase a3-3 in complex with glutathione and delta-4- androstene-3-17-dione
PDB Compounds: (I:) glutathione s-transferase a3

SCOPe Domain Sequences for d2vcvi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vcvi1 c.47.1.0 (I:4-80) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmveidgm
klvqtrailnyiaskyn

SCOPe Domain Coordinates for d2vcvi1:

Click to download the PDB-style file with coordinates for d2vcvi1.
(The format of our PDB-style files is described here.)

Timeline for d2vcvi1: