SCOPe 2.04: Domain d2vcva2: 2vcv A:81-222

Lineage for d2vcva2 (2vcv A:81-222)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224956] (35 PDB entries)

8. Domain d2vcva2: 2vcv A:81-222 [206301]
   Other proteins in same PDB: d2vcva1, d2vcvb1, d2vcvc1, d2vcvd1, d2vcve1, d2vcvf1, d2vcvg1, d2vcvh1, d2vcvi1, d2vcvj1, d2vcvk1, d2vcvl1, d2vcvm1, d2vcvn1, d2vcvo1, d2vcvp1
   automated match to d1agsa1
   complexed with asd, gsh

Details for d2vcva2

PDB Entry: 2vcv, 1.8 Å

PDB Description: glutathione transferase a3-3 in complex with glutathione and delta-4- androstene-3-17-dione

PDB Compounds: (A:) glutathione s-transferase a3

SCOPe Domain Sequences for d2vcva2:

Sequence; same for both SEQRES and ATOM records:

>d2vcva2 a.45.1.1 (A:81-222) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lygkdikeralidmytegmadlnemilllplcrpeekdakialikektksryfpafekvl
qshgqdylvgnklsradislvellyyveeldsslisnfpllkalktrisnlptvkkflqp
gsprkppadakaleearkifrf

Timeline for d2vcva2:

• d2vcva2 first appeared in SCOPe 2.03
  
• d2vcva2 appears in SCOPe 2.05
  
• d2vcva2 appears in the current release, SCOPe 2.08