SCOPe 2.04: Domain d2vcvo1: 2vcv O:4-80

Lineage for d2vcvo1 (2vcv O:4-80)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (133 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (91 PDB entries)

8. Domain d2vcvo1: 2vcv O:4-80 [206328]
   Other proteins in same PDB: d2vcva2, d2vcvb2, d2vcvc2, d2vcvd2, d2vcve2, d2vcvf2, d2vcvg2, d2vcvh2, d2vcvi2, d2vcvj2, d2vcvk2, d2vcvl2, d2vcvm2, d2vcvn2, d2vcvo2, d2vcvp2
   automated match to d1k3ya2
   complexed with asd, gsh

Details for d2vcvo1

PDB Entry: 2vcv, 1.8 Å

PDB Description: glutathione transferase a3-3 in complex with glutathione and delta-4- androstene-3-17-dione

PDB Compounds: (O:) glutathione s-transferase a3

SCOPe Domain Sequences for d2vcvo1:

Sequence; same for both SEQRES and ATOM records:

>d2vcvo1 c.47.1.0 (O:4-80) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmveidgm
klvqtrailnyiaskyn

Timeline for d2vcvo1:

• d2vcvo1 first appeared in SCOPe 2.03
  
• d2vcvo1 appears in SCOPe 2.05
  
• d2vcvo1 appears in the current release, SCOPe 2.08