Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (147 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188013] (102 PDB entries) |
Domain d2vcvi1: 2vcv I:4-80 [206316] Other proteins in same PDB: d2vcva2, d2vcvb2, d2vcvc2, d2vcvd2, d2vcve2, d2vcvf2, d2vcvg2, d2vcvh2, d2vcvi2, d2vcvj2, d2vcvk2, d2vcvl2, d2vcvm2, d2vcvn2, d2vcvo2, d2vcvp2 automated match to d1k3ya2 complexed with asd, gsh |
PDB Entry: 2vcv (more details), 1.8 Å
SCOPe Domain Sequences for d2vcvi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vcvi1 c.47.1.0 (I:4-80) automated matches {Human (Homo sapiens) [TaxId: 9606]} kpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmveidgm klvqtrailnyiaskyn
Timeline for d2vcvi1:
View in 3D Domains from other chains: (mouse over for more information) d2vcva1, d2vcva2, d2vcvb1, d2vcvb2, d2vcvc1, d2vcvc2, d2vcvd1, d2vcvd2, d2vcve1, d2vcve2, d2vcvf1, d2vcvf2, d2vcvg1, d2vcvg2, d2vcvh1, d2vcvh2, d2vcvj1, d2vcvj2, d2vcvk1, d2vcvk2, d2vcvl1, d2vcvl2, d2vcvm1, d2vcvm2, d2vcvn1, d2vcvn2, d2vcvo1, d2vcvo2, d2vcvp1, d2vcvp2 |