Lineage for d2vcvf2 (2vcv F:81-222)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713549Protein automated matches [226848] (14 species)
    not a true protein
  7. 2713569Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)
  8. 2713620Domain d2vcvf2: 2vcv F:81-222 [206311]
    Other proteins in same PDB: d2vcva1, d2vcvb1, d2vcvc1, d2vcvd1, d2vcve1, d2vcvf1, d2vcvg1, d2vcvh1, d2vcvi1, d2vcvj1, d2vcvk1, d2vcvl1, d2vcvm1, d2vcvn1, d2vcvo1, d2vcvp1
    automated match to d1agsa1
    complexed with asd, gsh

Details for d2vcvf2

PDB Entry: 2vcv (more details), 1.8 Å

PDB Description: glutathione transferase a3-3 in complex with glutathione and delta-4- androstene-3-17-dione
PDB Compounds: (F:) glutathione s-transferase a3

SCOPe Domain Sequences for d2vcvf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vcvf2 a.45.1.1 (F:81-222) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lygkdikeralidmytegmadlnemilllplcrpeekdakialikektksryfpafekvl
qshgqdylvgnklsradislvellyyveeldsslisnfpllkalktrisnlptvkkflqp
gsprkppadakaleearkifrf

SCOPe Domain Coordinates for d2vcvf2:

Click to download the PDB-style file with coordinates for d2vcvf2.
(The format of our PDB-style files is described here.)

Timeline for d2vcvf2: