![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
![]() | Protein automated matches [190056] (195 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries) |
![]() | Domain d2vcvj1: 2vcv J:4-80 [206318] Other proteins in same PDB: d2vcva2, d2vcvb2, d2vcvc2, d2vcvd2, d2vcve2, d2vcvf2, d2vcvg2, d2vcvh2, d2vcvi2, d2vcvj2, d2vcvk2, d2vcvl2, d2vcvm2, d2vcvn2, d2vcvo2, d2vcvp2 automated match to d1k3ya2 complexed with asd, gsh |
PDB Entry: 2vcv (more details), 1.8 Å
SCOPe Domain Sequences for d2vcvj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vcvj1 c.47.1.0 (J:4-80) automated matches {Human (Homo sapiens) [TaxId: 9606]} kpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmveidgm klvqtrailnyiaskyn
Timeline for d2vcvj1:
![]() Domains from other chains: (mouse over for more information) d2vcva1, d2vcva2, d2vcvb1, d2vcvb2, d2vcvc1, d2vcvc2, d2vcvd1, d2vcvd2, d2vcve1, d2vcve2, d2vcvf1, d2vcvf2, d2vcvg1, d2vcvg2, d2vcvh1, d2vcvh2, d2vcvi1, d2vcvi2, d2vcvk1, d2vcvk2, d2vcvl1, d2vcvl2, d2vcvm1, d2vcvm2, d2vcvn1, d2vcvn2, d2vcvo1, d2vcvo2, d2vcvp1, d2vcvp2 |