PDB entry 2vcv

View 2vcv on RCSB PDB site
Description: Glutathione transferase A3-3 in complex with glutathione and delta-4- androstene-3-17-dione
Class: transferase
Keywords: andostrene dione, steroid metabolism, transferase, glutathione
Deposited on 2007-09-27, released 2008-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.225
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase a3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vcva1, d2vcva2
  • Chain 'B':
    Compound: glutathione s-transferase a3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vcvb1, d2vcvb2
  • Chain 'C':
    Compound: glutathione s-transferase a3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vcvc1, d2vcvc2
  • Chain 'D':
    Compound: glutathione s-transferase a3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vcvd1, d2vcvd2
  • Chain 'E':
    Compound: glutathione s-transferase a3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vcve1, d2vcve2
  • Chain 'F':
    Compound: glutathione s-transferase a3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vcvf1, d2vcvf2
  • Chain 'G':
    Compound: glutathione s-transferase a3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vcvg1, d2vcvg2
  • Chain 'H':
    Compound: glutathione s-transferase a3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vcvh1, d2vcvh2
  • Chain 'I':
    Compound: glutathione s-transferase a3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vcvi1, d2vcvi2
  • Chain 'J':
    Compound: glutathione s-transferase a3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vcvj1, d2vcvj2
  • Chain 'K':
    Compound: glutathione s-transferase a3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vcvk1, d2vcvk2
  • Chain 'L':
    Compound: glutathione s-transferase a3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vcvl1, d2vcvl2
  • Chain 'M':
    Compound: glutathione s-transferase a3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vcvm1, d2vcvm2
  • Chain 'N':
    Compound: glutathione s-transferase a3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vcvn1, d2vcvn2
  • Chain 'O':
    Compound: glutathione s-transferase a3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vcvo1, d2vcvo2
  • Chain 'P':
    Compound: glutathione s-transferase a3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vcvp1, d2vcvp2
  • Heterogens: GSH, ASD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vcvA (A:)
    magkpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdak
    ialikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpl
    lkalktrisnlptvkkflqpgsprkppadakaleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcvA (A:)
    kpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdakial
    ikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpllka
    lktrisnlptvkkflqpgsprkppadakaleearkifrf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vcvB (B:)
    magkpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdak
    ialikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpl
    lkalktrisnlptvkkflqpgsprkppadakaleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcvB (B:)
    kpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdakial
    ikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpllka
    lktrisnlptvkkflqpgsprkppadakaleearkifrf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vcvC (C:)
    magkpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdak
    ialikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpl
    lkalktrisnlptvkkflqpgsprkppadakaleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcvC (C:)
    kpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdakial
    ikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpllka
    lktrisnlptvkkflqpgsprkppadakaleearkifrf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vcvD (D:)
    magkpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdak
    ialikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpl
    lkalktrisnlptvkkflqpgsprkppadakaleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcvD (D:)
    kpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdakial
    ikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpllka
    lktrisnlptvkkflqpgsprkppadakaleearkifrf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2vcvE (E:)
    magkpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdak
    ialikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpl
    lkalktrisnlptvkkflqpgsprkppadakaleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcvE (E:)
    kpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdakial
    ikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpllka
    lktrisnlptvkkflqpgsprkppadakaleearkifrf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2vcvF (F:)
    magkpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdak
    ialikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpl
    lkalktrisnlptvkkflqpgsprkppadakaleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcvF (F:)
    kpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdakial
    ikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpllka
    lktrisnlptvkkflqpgsprkppadakaleearkifrf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2vcvG (G:)
    magkpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdak
    ialikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpl
    lkalktrisnlptvkkflqpgsprkppadakaleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcvG (G:)
    kpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdakial
    ikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpllka
    lktrisnlptvkkflqpgsprkppadakaleearkifrf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2vcvH (H:)
    magkpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdak
    ialikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpl
    lkalktrisnlptvkkflqpgsprkppadakaleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcvH (H:)
    kpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdakial
    ikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpllka
    lktrisnlptvkkflqpgsprkppadakaleearkifrf
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2vcvI (I:)
    magkpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdak
    ialikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpl
    lkalktrisnlptvkkflqpgsprkppadakaleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcvI (I:)
    kpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdakial
    ikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpllka
    lktrisnlptvkkflqpgsprkppadakaleearkifrf
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2vcvJ (J:)
    magkpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdak
    ialikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpl
    lkalktrisnlptvkkflqpgsprkppadakaleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcvJ (J:)
    kpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdakial
    ikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpllka
    lktrisnlptvkkflqpgsprkppadakaleearkifrf
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2vcvK (K:)
    magkpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdak
    ialikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpl
    lkalktrisnlptvkkflqpgsprkppadakaleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcvK (K:)
    kpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdakial
    ikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpllka
    lktrisnlptvkkflqpgsprkppadakaleearkifrf
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2vcvL (L:)
    magkpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdak
    ialikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpl
    lkalktrisnlptvkkflqpgsprkppadakaleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcvL (L:)
    kpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdakial
    ikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpllka
    lktrisnlptvkkflqpgsprkppadakaleearkifrf
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2vcvM (M:)
    magkpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdak
    ialikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpl
    lkalktrisnlptvkkflqpgsprkppadakaleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcvM (M:)
    kpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdakial
    ikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpllka
    lktrisnlptvkkflqpgsprkppadakaleearkifrf
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2vcvN (N:)
    magkpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdak
    ialikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpl
    lkalktrisnlptvkkflqpgsprkppadakaleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcvN (N:)
    kpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdakial
    ikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpllka
    lktrisnlptvkkflqpgsprkppadakaleearkifrf
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2vcvO (O:)
    magkpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdak
    ialikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpl
    lkalktrisnlptvkkflqpgsprkppadakaleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcvO (O:)
    kpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdakial
    ikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpllka
    lktrisnlptvkkflqpgsprkppadakaleearkifrf
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2vcvP (P:)
    magkpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdak
    ialikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpl
    lkalktrisnlptvkkflqpgsprkppadakaleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcvP (P:)
    kpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmytegmadlnemilllplcrpeekdakial
    ikektksryfpafekvlqshgqdylvgnklsradislvellyyveeldsslisnfpllka
    lktrisnlptvkkflqpgsprkppadakaleearkifrf