Lineage for d2p4vb1 (2p4v B:1-79)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1718782Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1718783Superfamily a.2.1: GreA transcript cleavage protein, N-terminal domain [46557] (2 families) (S)
    automatically mapped to Pfam PF03449
  5. 1718799Family a.2.1.0: automated matches [227221] (1 protein)
    not a true family
  6. 1718800Protein automated matches [226962] (1 species)
    not a true protein
  7. 1718801Species Escherichia coli [TaxId:562] [225398] (1 PDB entry)
  8. 1718803Domain d2p4vb1: 2p4v B:1-79 [205441]
    Other proteins in same PDB: d2p4va2, d2p4vb2, d2p4vc2, d2p4vd2, d2p4ve2, d2p4vf2
    automated match to d1grja1

Details for d2p4vb1

PDB Entry: 2p4v (more details), 2.6 Å

PDB Description: Crystal structure of the transcript cleavage factor, GreB at 2.6A resolution
PDB Compounds: (B:) Transcription elongation factor greB

SCOPe Domain Sequences for d2p4vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p4vb1 a.2.1.0 (B:1-79) automated matches {Escherichia coli [TaxId: 562]}
mktplvtregyeklkqelnylwreerpevtkkvtwaaslgdrsenadyqynkkrlreidr
rvryltkcmenlkivdysp

SCOPe Domain Coordinates for d2p4vb1:

Click to download the PDB-style file with coordinates for d2p4vb1.
(The format of our PDB-style files is described here.)

Timeline for d2p4vb1: