SCOPe 2.05: Domain d2p4va2: 2p4v A:80-156

Lineage for d2p4va2 (2p4v A:80-156)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (23 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [225399] (1 PDB entry)

8. Domain d2p4va2: 2p4v A:80-156 [205440]
   Other proteins in same PDB: d2p4va1, d2p4vb1, d2p4vc1, d2p4vd1, d2p4ve1, d2p4vf1
   automated match to d1grja2

Details for d2p4va2

PDB Entry: 2p4v, 2.6 Å

PDB Description: Crystal structure of the transcript cleavage factor, GreB at 2.6A resolution

PDB Compounds: (A:) Transcription elongation factor greB

SCOPe Domain Sequences for d2p4va2:

Sequence; same for both SEQRES and ATOM records:

>d2p4va2 d.26.1.0 (A:80-156) automated matches {Escherichia coli [TaxId: 562]}
qqegkvffgawveienddgvthrfrivgydeifgrkdyisidspmarallkkevgdlavv
ntpageaswyvnaieyv

Timeline for d2p4va2:

• d2p4va2 first appeared in SCOPe 2.03
  
• d2p4va2 appears in SCOPe 2.04
  
• d2p4va2 appears in SCOPe 2.06
  
• d2p4va2 appears in the current release, SCOPe 2.08