SCOPe 2.05: Domain d2p4va1: 2p4v A:1-79

Lineage for d2p4va1 (2p4v A:1-79)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.1: GreA transcript cleavage protein, N-terminal domain [46557] (2 families)
   automatically mapped to Pfam PF03449

5. Family a.2.1.0: automated matches [227221] (1 protein)
   not a true family

6. Protein automated matches [226962] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [225398] (1 PDB entry)

8. Domain d2p4va1: 2p4v A:1-79 [205439]
   Other proteins in same PDB: d2p4va2, d2p4vb2, d2p4vc2, d2p4vd2, d2p4ve2, d2p4vf2
   automated match to d1grja1

Details for d2p4va1

PDB Entry: 2p4v, 2.6 Å

PDB Description: Crystal structure of the transcript cleavage factor, GreB at 2.6A resolution

PDB Compounds: (A:) Transcription elongation factor greB

SCOPe Domain Sequences for d2p4va1:

Sequence; same for both SEQRES and ATOM records:

>d2p4va1 a.2.1.0 (A:1-79) automated matches {Escherichia coli [TaxId: 562]}
mktplvtregyeklkqelnylwreerpevtkkvtwaaslgdrsenadyqynkkrlreidr
rvryltkcmenlkivdysp

Timeline for d2p4va1:

• d2p4va1 first appeared in SCOPe 2.03
  
• d2p4va1 appears in SCOPe 2.04
  
• d2p4va1 appears in SCOPe 2.06
  
• d2p4va1 appears in the current release, SCOPe 2.08