Lineage for d2nz2a1 (2nz2 A:4-171)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590910Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1591169Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 1591170Protein automated matches [190116] (16 species)
    not a true protein
  7. 1591202Species Human (Homo sapiens) [TaxId:9606] [225190] (1 PDB entry)
  8. 1591203Domain d2nz2a1: 2nz2 A:4-171 [205202]
    Other proteins in same PDB: d2nz2a2
    automated match to d1vl2a1
    complexed with asp, cir, na

Details for d2nz2a1

PDB Entry: 2nz2 (more details), 2.4 Å

PDB Description: crystal structure of human argininosuccinate synthase in complex with aspartate and citrulline
PDB Compounds: (A:) argininosuccinate synthase

SCOPe Domain Sequences for d2nz2a1:

Sequence, based on SEQRES records: (download)

>d2nz2a1 c.26.2.0 (A:4-171) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgsvvlaysggldtscilvwlkeqgydviaylanigqkedfeearkkalklgakkvfied
vsrefveefiwpaiqssalyedryllgtslarpciarkqveiaqregakyvshgatgkgn
dqvrfelscyslapqikviapwrmpefynrfkgrndlmeyakqhgipi

Sequence, based on observed residues (ATOM records): (download)

>d2nz2a1 c.26.2.0 (A:4-171) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgsvvlaysggldtscilvwlkeqgydviaylanigqkedfeearkkalklgakkvfied
vsrefveefiwpaiqssalyedryllgtslarpciarkqveiaqregakyvshgatgkgn
dqvrfelscyslapqikviapwrmpefynrfkrndlmeyakqhgipi

SCOPe Domain Coordinates for d2nz2a1:

Click to download the PDB-style file with coordinates for d2nz2a1.
(The format of our PDB-style files is described here.)

Timeline for d2nz2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nz2a2