SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2nz2a1 (2nz2 A:4-171)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2106293Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2106562Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2106563Protein automated matches [190116] (21 species)
    not a true protein
  7. 2106605Species Human (Homo sapiens) [TaxId:9606] [225190] (1 PDB entry)
  8. 2106606Domain d2nz2a1: 2nz2 A:4-171 [205202]
    Other proteins in same PDB: d2nz2a2
    automated match to d1vl2a1
    complexed with asp, cir, na

Details for d2nz2a1

PDB Entry: 2nz2 (more details), 2.4 Å

PDB Description: Crystal structure of human argininosuccinate synthase in complex with aspartate and citrulline
PDB Compounds: (A:) argininosuccinate synthase

SCOPe Domain Sequences for d2nz2a1:

Sequence, based on SEQRES records: (download)

>d2nz2a1 c.26.2.0 (A:4-171) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgsvvlaysggldtscilvwlkeqgydviaylanigqkedfeearkkalklgakkvfied
vsrefveefiwpaiqssalyedryllgtslarpciarkqveiaqregakyvshgatgkgn
dqvrfelscyslapqikviapwrmpefynrfkgrndlmeyakqhgipi

Sequence, based on observed residues (ATOM records): (download)

>d2nz2a1 c.26.2.0 (A:4-171) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgsvvlaysggldtscilvwlkeqgydviaylanigqkedfeearkkalklgakkvfied
vsrefveefiwpaiqssalyedryllgtslarpciarkqveiaqregakyvshgatgkgn
dqvrfelscyslapqikviapwrmpefynrfkrndlmeyakqhgipi

SCOPe Domain Coordinates for d2nz2a1:

Click to download the PDB-style file with coordinates for d2nz2a1.
(The format of our PDB-style files is described here.)

Timeline for d2nz2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nz2a2