SCOPe 2.05: Domain d2nz2a1: 2nz2 A:4-171

Lineage for d2nz2a1 (2nz2 A:4-171)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225190] (1 PDB entry)

8. Domain d2nz2a1: 2nz2 A:4-171 [205202]
   Other proteins in same PDB: d2nz2a2
   automated match to d1vl2a1
   complexed with asp, cir, na

Details for d2nz2a1

PDB Entry: 2nz2, 2.4 Å

PDB Description: crystal structure of human argininosuccinate synthase in complex with aspartate and citrulline

PDB Compounds: (A:) argininosuccinate synthase

SCOPe Domain Sequences for d2nz2a1:

Sequence, based on SEQRES records:

>d2nz2a1 c.26.2.0 (A:4-171) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgsvvlaysggldtscilvwlkeqgydviaylanigqkedfeearkkalklgakkvfied
vsrefveefiwpaiqssalyedryllgtslarpciarkqveiaqregakyvshgatgkgn
dqvrfelscyslapqikviapwrmpefynrfkgrndlmeyakqhgipi

Sequence, based on observed residues (ATOM records):

>d2nz2a1 c.26.2.0 (A:4-171) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgsvvlaysggldtscilvwlkeqgydviaylanigqkedfeearkkalklgakkvfied
vsrefveefiwpaiqssalyedryllgtslarpciarkqveiaqregakyvshgatgkgn
dqvrfelscyslapqikviapwrmpefynrfkrndlmeyakqhgipi

Timeline for d2nz2a1:

• d2nz2a1 first appeared in SCOPe 2.03
  
• d2nz2a1 appears in SCOPe 2.04
  
• d2nz2a1 appears in SCOPe 2.06
  
• d2nz2a1 appears in the current release, SCOPe 2.08